The device has a cutting table unit with a break edge (61) that extends parallel to two crushing shafts (30). A turning knife (63) associating a rotatable knife to one shaft is arranged in a transverse direction at the edge. The knife (63) associating the rotatable knife to other shaft is arranged in the transverse direction on another side at the edge. The rotatable knives of both the shafts exte...

The present invention relates to an inspection system for inspection of an object, comprising at least an image recording means (30, 30') carried by an inspector (20, 20'), a display unit, a storage unit and a contact free positioning unit (40). The storage unit is arranged to store at least an image taken by said imaged recording unit (30, 30') in relation to a position given by said positioning ...

The present invention is directed to improve processes for making plastic articles, and articles made therefrom. In a broad aspect, the invention is directed to improved processes and articles made therefrom, that include the steps of providing as separate materials a first material that includes a polyolefin, a second material including an admixture of from about 45 to 85 wt.% of the total admixt...

The system (10) has data transmission units (21, 21', 43) connected on a mobile service terminal equipment (20). A crane data structure is readable by a data processor, where the structure has data for identifying a crane (11). The structure has a software for transmitting data with the equipment by the transmission units. The software includes data sets for identifying the equipment for reading t...

Provided is a polypeptide having no' more than 100 amino acids, which polypeptide comprises one or more sequences having at least 60% homology with any of SEQ ID 1-6, or comprises two or more epitopes having 7 amino acids or more, each epitope having at least 60% homology with a sub-sequence of any of SEQ ID 1-6 that has the same length as the epitope: SEQ ID 1 DLEALMEWLKTRPILSPLTKGILGFVFTLTVP SEQ...

A novel bicyclic imidazo-5-yl-amine derivative of Formula I,wherein X denotes CR<5>, N or S, and Y in the case where X denotes S, denotes CR<6 >or N and in all other cases denotes N, and methods for preparation thereof are disclosed. Also disclosed are methods for treating pain using the compound of Formula I, and pharmaceutical compositions comprising the compound of Formula I.

The invention relates to an electrically conductive, elastically stretchable hybrid yarn (3), in which an elastically stretchable core filament (1) is surrounded by an electrically conductive fibre sheath (2). This results in improved technical properties of a hybrid yarn of this kind in conjunction with a simplified manufacturing method.

Electrodeionisation devices having low scale potential as well water treatment methods using the device are disclosed. The device may have a variety of configurations such as a first depleting compartment disposed between the anode compartment and the cathode compartment, a concentrating compartment in ionic coummunication with the depleting compartment, a second depleting compartment in ionic com...

The invention discloses a multilayer of cholesteric liquid crystal polymer (CLCP), wherein at least two layers of CLCP differing in at least one optical property are arranged on top of each other, characterized in that said at least two layers are chemically inter-layer cross-linked through the polymer network, such as to form a mechanically unique solid body which can be comminuted to pigment wit...

A chamber of a second forming tool(3) located in a first forming tool(1) or a chamber(18) in the first forming tool is filled with a flowable molding material. First and second forming tools are then moved relative to each other so that material is partially purged from the chamber. A thin wall(7) of material remaining between the inner wall(16) of the first forming tool and outer wall(15) of the ...

A water-redispersible powder composition comprising: at least a water-soluble film forming polymer, the polymer being prepared from at least an ethylenically unsaturated monomer; and at least a naphthalenesulphonate.

In a process for preserving a mineral molding by coating the surface of the mineral molding with an aqueous composition comprising an aqueous polymer dispersion, the dispersed polymer P comprises an ethylenically unsaturated acid of the 2-acrylamido-2-methylpropanesulfonic acid type polymerized into it in free-radically polymerized form.

A package assembly 10 for the storage and distribution of a plurality of stacked mints 12 is provided. The package assembly 10 includes a cylindrical outer shell 14 including a shell sidewall 16 , a shell bottom surface 18 , and a shell open top 20 . The shell sidewall 16 includes a sidewall inner surface 22 and a sidewall outer surface 24 . A vertical control slot 28 is formed in the shell sidewa...

Tumor-associated peptides (I) having any of 79 sequences, reproduced, are new. (I) can bind to a Class I molecule of the human major histocompatibility complex (MHC). Independent claims are also included for the following: (1) nucleic acid (II) that encodes (I); (2) vector that contains (II); and (3) cell modified to express (I), by incorporation of (II) or the vector of (2). - ACTIVITY : Cytostat...

The invention provides new methods for synthesis of 2-aralkyloxyadenosines and 2-alkoxyadenosines. The invention is particularly useful for synthesis of 2-[2-(4-chlorophenyl)ethoxy]adenosine. Preferred methods of the invention include activating a guanosine compound followed by hydrolysis; alkylating the hydrolyzed compound with subsequent animation to provide a 2-aralkyloxyadenosine or a 2-alkoxy...

The present invention relates to micro-sized particles having anti-biocontaminant properties. Each particle is comprised of a central metal core, or support structure, (for example, alumina oxide) and has on its surface, one or more anti-biocontaminant metals and at least one redox agent.; La presente invención se refiere a partículas de micro-tamaño que tienen propiedades anti-biocontaminantes. C...

An apparatus and method for removing skin and fat from meat parts, a tooth roll assembly attached to a frame and a trimming blade assembly attached to an adjustable frame where the position of the trimming blade assembly is adjusted in relation to the tooth roll assembly based upon the thickness of a layer of fat of the meat part.

La presente invencion esta relacionada con metodos para usar el receptor GPR119 con el fin de identificar compuestos utiles para aumentar la masa osea en un individuo.; The present invention relates to methods of using GPR119 receptor to identify compounds useful for increasing bone mass in an individual. Agonists of GPR119 receptor are useful as therapeutic agents for treating or preventing a con...

Novel modified release pharmaceutical compositions wherein the composition comprises at least one antibiotic(s) preferably amoxicillin or its pharmaceutically acceptable salts, esters, polymorphs, isomers, prodrugs, solvates, hydrates, or derivatives thereof either alone or in combination with other antibiotic(s) as active ingredient, with at least one release modifying agent(s) for controlling th...